PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00023388001
Common NameGSBRNA2T00023388001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 298aa    MW: 32310.8 Da    PI: 9.0113
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00023388001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-381777262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  GSBRNA2T00023388001 17 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 77
                         56789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.1E-332075IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-272175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9012175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MQSKNMIVSP SHQQQPPQPQ LKCPRCDSSN TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT  60
LRNVPVGGSY RKNKRVKRPA TATAASTAST TTSSSLNNPH HQISHFPSMN HHPLFYGLSD  120
HVSSCNSLPM FPSRFSDPPK TSSGLEGEFL SSGFNGLGLG LQNHMSHDQT INGSFINNST  180
TNKPFLPSSL FGSSVSSSSS TLLQHAHKPM NNNGEMMGQS HLQTLASLQD LHVGGDNEDV  240
NKEGKLGEIS GDMNGFMSSS SLDPSNYHNN WNNASVSSGA WLDPTNNIVG SSLTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530650.0AK353065.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-D16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013677584.10.0PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-137DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078JZC10.0A0A078JZC1_BRANA; BnaCnng75710D protein
STRINGBra032891.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-120Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]